PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g59420.2.p
Common NameBRADI_3g59420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 152aa    MW: 17979.9 Da    PI: 10.4695
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g59420.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.66.6e-252169452
            RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                      +++le++s+yF +p+k+AA eL+v++T+LKr CR++ I RWPhRk+ksl
  Bradi3g59420.2.p 21 SLRLEQVSQYFCMPLKQAAEELKVGQTTLKRSCRELRILRWPHRKVKSL 69
                      799********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.426190IPR003035RWP-RK domain
PfamPF020421.4E-212269IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MEKATKNEEH LSDGSQREKP SLRLEQVSQY FCMPLKQAAE ELKVGQTTLK RSCRELRILR  60
WPHRKVKSLQ TLIENVQELE KDDVLGRSEK IRAVVQILQQ RQKLMEERPA GVVELDKETR  120
IFMQACYKEM YNRRRKGVKF AWMRSDRAGF R*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756080.11e-108PREDICTED: protein RKD1-like
TrEMBLI1IFB71e-106I1IFB7_BRADI; Uncharacterized protein
STRINGBRADI3G59420.11e-106(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-26RWP-RK domain-containing protein